Lineage for d2fbjh1 (2fbj H:1-118)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7727Species Fab J539 (mouse), kappa L chain [48768] (1 PDB entry)
  8. 7728Domain d2fbjh1: 2fbj H:1-118 [19851]
    Other proteins in same PDB: d2fbjh2, d2fbjl2

Details for d2fbjh1

PDB Entry: 2fbj (more details), 1.95 Å

PDB Description: refined crystal structure of the galactan-binding immunoglobulin fab j539 at 1.95-angstroms resolution

SCOP Domain Sequences for d2fbjh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin (variable domains of L and H chains) {Fab J539 (mouse), kappa L chain}
evkllesggglvqpggslklscaasgfdfskywmswvrqapgkglewigeihpdsgtiny
tpslkdkfiisrdnaknslylqmskvrsedtalyycarlhyygynaywgqgtlvtvsa

SCOP Domain Coordinates for d2fbjh1:

Click to download the PDB-style file with coordinates for d2fbjh1.
(The format of our PDB-style files is described here.)

Timeline for d2fbjh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fbjh2