SCOPe 2.03: Domain d2wipb2: 2wip B:310-432

Lineage for d2wipb2 (2wip B:310-432)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (73 PDB entries)
   Uniprot P20248 175-432

8. Domain d2wipb2: 2wip B:310-432 [198506]
   Other proteins in same PDB: d2wipa_, d2wipc_
   automated match to d1vywb2
   complexed with p49, so4

Details for d2wipb2

PDB Entry: 2wip, 2.8 Å

PDB Description: structure of cdk2-cyclin a complexed with 8-anilino-1-methyl-4,5- dihydro- 1h-pyrazolo[4,3-h] quinazoline-3-carboxylic acid

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d2wipb2:

Sequence; same for both SEQRES and ATOM records:

>d2wipb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d2wipb2:

• d2wipb2 is new in SCOPe 2.03-stable
  
• d2wipb2 appears in SCOPe 2.04
  
• d2wipb2 appears in the current release, SCOPe 2.08