SCOP 1.65: Domain d2fbjl1: 2fbj L:1-109

Lineage for d2fbjl1 (2fbj L:1-109)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.4 [TaxId:10090] [88530] (3 PDB entries)

8. Domain d2fbjl1: 2fbj L:1-109 [19850]
   Other proteins in same PDB: d2fbjh1, d2fbjh2, d2fbjl2
   part of Fab J539
   complexed with fuc, nag, zn

Details for d2fbjl1

PDB Entry: 2fbj, 1.95 Å

PDB Description: refined crystal structure of the galactan-binding immunoglobulin fab j539 at 1.95-angstroms resolution

SCOP Domain Sequences for d2fbjl1:

Sequence; same for both SEQRES and ATOM records:

>d2fbjl1 b.1.1.1 (L:1-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.4}
eivltqspaitaaslgqkvtitcsasssvsslhwyqqksgtspkpwiyeisklasgvpar
fsgsgsgtsysltintmeaedaaiyycqqwtyplitfgagtklelkrad

Timeline for d2fbjl1:

• d2fbjl1 first appeared (with stable ids) in SCOP 1.55
  
• d2fbjl1 appears in SCOP 1.63
  
• d2fbjl1 appears in SCOP 1.67
  
• d2fbjl1 appears in the current release, SCOPe 2.08