Lineage for d2ig2h1 (2ig2 H:1-119)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 362839Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (11 PDB entries)
  8. 362854Domain d2ig2h1: 2ig2 H:1-119 [19849]
    Other proteins in same PDB: d2ig2h2, d2ig2l1, d2ig2l2
    part of antibody KOL; intact protein but only Fab's can be seen in the crystal structure

Details for d2ig2h1

PDB Entry: 2ig2 (more details), 3 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda- typ, subgruppe i (german)

SCOP Domain Sequences for d2ig2h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ig2h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3}
evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
adsvkgrftisrndskntlflqmdslrpedtgvyfcardgghgfcssascfgpdywgqgt
pvtvssa

SCOP Domain Coordinates for d2ig2h1:

Click to download the PDB-style file with coordinates for d2ig2h1.
(The format of our PDB-style files is described here.)

Timeline for d2ig2h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ig2h2