SCOPe 2.04: Domain d2wdqi3: 2wdq I:451-588

Lineage for d2wdqi3 (2wdq I:451-588)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family)

5. Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)

6. Protein Succinate dehydogenase [81708] (2 species)

7. Species Escherichia coli [TaxId:562] [81709] (6 PDB entries)

8. Domain d2wdqi3: 2wdq I:451-588 [198487]
   Other proteins in same PDB: d2wdqa1, d2wdqa2, d2wdqb1, d2wdqb2, d2wdqc_, d2wdqd_, d2wdqe1, d2wdqe2, d2wdqf1, d2wdqf2, d2wdqg_, d2wdqh_, d2wdqi1, d2wdqi2, d2wdqj1, d2wdqj2, d2wdqk_, d2wdql_
   automated match to d1neka1
   complexed with cbe, f3s, fad, fes, hem, na, sf4, so4, teo

Details for d2wdqi3

PDB Entry: 2wdq, 2.4 Å

PDB Description: e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound

PDB Compounds: (I:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d2wdqi3:

Sequence; same for both SEQRES and ATOM records:

>d2wdqi3 a.7.3.1 (I:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
rngedpvairkalqecmqhnfsvfregdamakgleqlkvirerlknarlddtssefntqr
vecleldnlmetayatavsanfrtesrgahsrfdfpdrddenwlchslylpesesmtrrs
vnmepklrpafppkirty

Timeline for d2wdqi3:

• d2wdqi3 first appeared in SCOPe 2.03
  
• d2wdqi3 appears in SCOPe 2.05
  
• d2wdqi3 appears in the current release, SCOPe 2.08