SCOPe 2.07: Domain d2ig2l1: 2ig2 L:1-109

Lineage for d2ig2l1 (2ig2 L:1-109)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88536] (10 PDB entries)

8. Domain d2ig2l1: 2ig2 L:1-109 [19848]
   Other proteins in same PDB: d2ig2h1, d2ig2h2, d2ig2l2
   part of antibody KOL; intact protein but only Fab's can be seen in the crystal structure

Details for d2ig2l1

PDB Entry: 2ig2, 3 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda- typ, subgruppe i (german)

PDB Compounds: (L:) igg1-lambda kol fab (light chain)

SCOPe Domain Sequences for d2ig2l1:

Sequence; same for both SEQRES and ATOM records:

>d2ig2l1 b.1.1.1 (L:1-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
qsvltqppsasgtpgqrvtiscsgtssnigsstvnwyqqlpgmapklliyrdamrpsgvp
drfsgsksgasaslaigglqsedetdyycaawdvslnayvfgtgtkvtvlg

Timeline for d2ig2l1:

• d2ig2l1 first appeared (with stable ids) in SCOP 1.55
  
• d2ig2l1 appears in SCOPe 2.06
  
• d2ig2l1 appears in the current release, SCOPe 2.08