Lineage for d2ig2l1 (2ig2 L:1-109)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7751Species Fab KOL (human), lambda L chain [48767] (2 PDB entries)
  8. 7755Domain d2ig2l1: 2ig2 L:1-109 [19848]
    Other proteins in same PDB: d2ig2h2, d2ig2l2

Details for d2ig2l1

PDB Entry: 2ig2 (more details), 3 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda-typ, subgruppe i (german)

SCOP Domain Sequences for d2ig2l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ig2l1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {Fab KOL (human), lambda L chain}
qsvltqppsasgtpgqrvtiscsgtssnigsstvnwyqqlpgmapklliyrdamrpsgvp
drfsgsksgasaslaigglqsedetdyycaawdvslnayvfgtgtkvtvlg

SCOP Domain Coordinates for d2ig2l1:

Click to download the PDB-style file with coordinates for d2ig2l1.
(The format of our PDB-style files is described here.)

Timeline for d2ig2l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ig2l2