Lineage for d2w9el2 (2w9e L:110-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752862Domain d2w9el2: 2w9e L:110-212 [198471]
    Other proteins in same PDB: d2w9ea_, d2w9eh_, d2w9el1
    automated match to d2fbjl2
    complexed with so4

Details for d2w9el2

PDB Entry: 2w9e (more details), 2.9 Å

PDB Description: structure of icsm 18 (anti-prp therapeutic antibody) fab fragment complexed with human prp fragment 119-231
PDB Compounds: (L:) icsm 18-anti-prp therapeutic fab light chain

SCOPe Domain Sequences for d2w9el2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w9el2 b.1.1.2 (L:110-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltgggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d2w9el2:

Click to download the PDB-style file with coordinates for d2w9el2.
(The format of our PDB-style files is described here.)

Timeline for d2w9el2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2w9el1