SCOPe 2.05: Domain d2fb4h1: 2fb4 H:1-119

Lineage for d2fb4h1 (2fb4 H:1-119)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)

8. Domain d2fb4h1: 2fb4 H:1-119 [19847]
   Other proteins in same PDB: d2fb4h2, d2fb4l1, d2fb4l2
   part of Fab KOL

Details for d2fb4h1

PDB Entry: 2fb4, 1.9 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda-typ, subgruppe i (german)

PDB Compounds: (H:) igg1-lambda kol fab (heavy chain)

SCOPe Domain Sequences for d2fb4h1:

Sequence; same for both SEQRES and ATOM records:

>d2fb4h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
adsvkgrftisrndskntlflqmdslrpedtgvyfcardgghgfcssascfgpdywgqgt
pvtvssa

Timeline for d2fb4h1:

• d2fb4h1 first appeared (with stable ids) in SCOP 1.55
  
• d2fb4h1 appears in SCOPe 2.04
  
• d2fb4h1 appears in SCOPe 2.06
  
• d2fb4h1 appears in the current release, SCOPe 2.08