![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Fab KOL (human), lambda L chain [48767] (2 PDB entries) |
![]() | Domain d2fb4h1: 2fb4 H:1-119 [19847] Other proteins in same PDB: d2fb4h2, d2fb4l2 |
PDB Entry: 2fb4 (more details), 1.9 Å
SCOP Domain Sequences for d2fb4h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fb4h1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Fab KOL (human), lambda L chain} evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy adsvkgrftisrndskntlflqmdslrpedtgvyfcardgghgfcssascfgpdywgqgt pvtvssa
Timeline for d2fb4h1: