Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) common fold is elaborated with additional secondary structures |
Family d.58.29.0: automated matches [191671] (1 protein) not a true family |
Protein automated matches [191274] (13 species) not a true protein |
Species Synechocystis sp. [TaxId:1148] [196081] (1 PDB entry) |
Domain d2w01e_: 2w01 E: [198465] automated match to d2w01f_ |
PDB Entry: 2w01 (more details), 2.31 Å
SCOPe Domain Sequences for d2w01e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w01e_ d.58.29.0 (E:) automated matches {Synechocystis sp. [TaxId: 1148]} kmggdrrpitiltsdlrgftstseglnpeevvkvlniyfgkmadvithhggtidefmgdg ilvlfgaptsqqddalravacgvemqlalrevnqqvtglglqplemgigintgevvvgni gsekrtkygvvgaqvnltyriesyttggqifissttleaagdrvhvngnrtvqpkgvkdp vviwdvagvgepynlslav
Timeline for d2w01e_: