Lineage for d2w01d_ (2w01 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954860Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2954861Protein automated matches [191274] (13 species)
    not a true protein
  7. 2954938Species Synechocystis sp. [TaxId:1148] [196081] (1 PDB entry)
  8. 2954942Domain d2w01d_: 2w01 D: [198464]
    automated match to d2w01f_

Details for d2w01d_

PDB Entry: 2w01 (more details), 2.31 Å

PDB Description: crystal structure of the guanylyl cyclase cya2
PDB Compounds: (D:) adenylate cyclase

SCOPe Domain Sequences for d2w01d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w01d_ d.58.29.0 (D:) automated matches {Synechocystis sp. [TaxId: 1148]}
kmggdrrpitiltsdlrgftstseglnpeevvkvlniyfgkmadvithhggtidefmgdg
ilvlfgaptsqqddalravacgvemqlalrevnqqvtglglqplemgigintgevvvgni
gsekrtkygvvgaqvnltyriesyttggqifissttleaagdrvhvngnrtvqpkgvkdp
vviwdvagvgepynlslav

SCOPe Domain Coordinates for d2w01d_:

Click to download the PDB-style file with coordinates for d2w01d_.
(The format of our PDB-style files is described here.)

Timeline for d2w01d_: