Lineage for d2vxtl1 (2vxt L:1-107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2034485Domain d2vxtl1: 2vxt L:1-107 [198457]
    Other proteins in same PDB: d2vxti_, d2vxtl2
    automated match to d1dqdl1
    complexed with cl, mg

Details for d2vxtl1

PDB Entry: 2vxt (more details), 1.49 Å

PDB Description: crystal structure of human il-18 complexed to murine reference antibody 125-2h fab
PDB Compounds: (L:) murine igg 125-2h

SCOPe Domain Sequences for d2vxtl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxtl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsaslgervsltcrasqdigsklywlqqepdgtfkrliyatssldsgvpk
rfsgsrsgsdysltisslesedfvdyyclqyasspytfgggtklaik

SCOPe Domain Coordinates for d2vxtl1:

Click to download the PDB-style file with coordinates for d2vxtl1.
(The format of our PDB-style files is described here.)

Timeline for d2vxtl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vxtl2
View in 3D
Domains from other chains:
(mouse over for more information)
d2vxti_