Lineage for d2vxql2 (2vxq L:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750430Domain d2vxql2: 2vxq L:108-213 [198456]
    Other proteins in same PDB: d2vxqa_, d2vxqh_, d2vxql1
    automated match to d1rhha2

Details for d2vxql2

PDB Entry: 2vxq (more details), 1.9 Å

PDB Description: crystal structure of the major grass pollen allergen phl p 2 in complex with its specific ige-fab
PDB Compounds: (L:) fab

SCOPe Domain Sequences for d2vxql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxql2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d2vxql2:

Click to download the PDB-style file with coordinates for d2vxql2.
(The format of our PDB-style files is described here.)

Timeline for d2vxql2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vxql1