SCOP 1.65: Domain d1faih1: 1fai H:1-123

Lineage for d1faih1 (1fai H:1-123)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)

8. Domain d1faih1: 1fai H:1-123 [19845]
   Other proteins in same PDB: d1faih2, d1fail1, d1fail2
   part of Fab R19.9

Details for d1faih1

PDB Entry: 1fai, 2.7 Å

PDB Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody

SCOP Domain Sequences for d1faih1:

Sequence; same for both SEQRES and ATOM records:

>d1faih1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqsgaelvragssvkmsckasgytftsygvnwvkqrpgqglewigyinpgkgylsy
nekfkgkttltvdrssstaymqlrsltsedaavyfcarsfyggsdlavyyfdswgqgttl
tvs

Timeline for d1faih1:

• d1faih1 first appeared (with stable ids) in SCOP 1.55
  
• d1faih1 appears in SCOP 1.63
  
• d1faih1 appears in SCOP 1.67
  
• d1faih1 appears in the current release, SCOPe 2.08