SCOP 1.61: Domain d1faih1: 1fai H:1-123

Lineage for d1faih1 (1fai H:1-123)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab R19.9 (mouse), kappa L chain [48766] (2 PDB entries)

8. Domain d1faih1: 1fai H:1-123 [19845]
   Other proteins in same PDB: d1faih2, d1fail2

Details for d1faih1

PDB Entry: 1fai, 2.7 Å

PDB Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody

SCOP Domain Sequences for d1faih1:

Sequence; same for both SEQRES and ATOM records:

>d1faih1 b.1.1.1 (H:1-123) Immunoglobulin (variable domains of L and H chains) {Fab R19.9 (mouse), kappa L chain}
qvqlqqsgaelvragssvkmsckasgytftsygvnwvkqrpgqglewigyinpgkgylsy
nekfkgkttltvdrssstaymqlrsltsedaavyfcarsfyggsdlavyyfdswgqgttl
tvs

Timeline for d1faih1:

• d1faih1 first appeared (with stable ids) in SCOP 1.55
  
• d1faih1 appears in SCOP 1.59
  
• d1faih1 appears in SCOP 1.63
  
• d1faih1 appears in the current release, SCOPe 2.08