Lineage for d1fail1 (1fai L:1-108)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653668Domain d1fail1: 1fai L:1-108 [19844]
    Other proteins in same PDB: d1faih1, d1faih2, d1fail2
    part of Fab R19.9

Details for d1fail1

PDB Entry: 1fai (more details), 2.7 Å

PDB Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody
PDB Compounds: (L:) igg2b-kappa r19.9 fab (light chain)

SCOP Domain Sequences for d1fail1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fail1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltisnlehediatyfcqqgstlprtfgggtkleikr

SCOP Domain Coordinates for d1fail1:

Click to download the PDB-style file with coordinates for d1fail1.
(The format of our PDB-style files is described here.)

Timeline for d1fail1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fail2