SCOPe 2.07: Domain d2vdml2: 2vdm L:108-214

Lineage for d2vdml2 (2vdm L:108-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d2vdml2: 2vdm L:108-214 [198434]
   Other proteins in same PDB: d2vdma_, d2vdmh1, d2vdml1
   automated match to d1dqdl2
   complexed with agg, ca, gol, mg, nag

Details for d2vdml2

PDB Entry: 2vdm, 2.9 Å

PDB Description: re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist tirofiban

PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d2vdml2:

Sequence; same for both SEQRES and ATOM records:

>d2vdml2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2vdml2:

• d2vdml2 first appeared in SCOPe 2.03
  
• d2vdml2 appears in SCOPe 2.06
  
• d2vdml2 appears in the current release, SCOPe 2.08