SCOPe 2.04: Domain d2vdll2: 2vdl L:108-214

Lineage for d2vdll2 (2vdl L:108-214)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d2vdll2: 2vdl L:108-214 [198432]
   Other proteins in same PDB: d2vdla_, d2vdlh1, d2vdll1
   automated match to d1dqdl2
   complexed with ca, cac, gol, mg, nag

Details for d2vdll2

PDB Entry: 2vdl, 2.75 Å

PDB Description: re-refinement of integrin alphaiibbeta3 headpiece

PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d2vdll2:

Sequence; same for both SEQRES and ATOM records:

>d2vdll2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2vdll2:

• d2vdll2 first appeared in SCOPe 2.03
  
• d2vdll2 appears in SCOPe 2.05
  
• d2vdll2 appears in the current release, SCOPe 2.08