Lineage for d2vdll1 (2vdl L:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766846Domain d2vdll1: 2vdl L:1-107 [198431]
    Other proteins in same PDB: d2vdla_, d2vdlh1, d2vdll2
    automated match to d1dqdl1
    complexed with ca, cac, gol, mg, nag

Details for d2vdll1

PDB Entry: 2vdl (more details), 2.75 Å

PDB Description: re-refinement of integrin alphaiibbeta3 headpiece
PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d2vdll1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdll1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik

SCOPe Domain Coordinates for d2vdll1:

Click to download the PDB-style file with coordinates for d2vdll1.
(The format of our PDB-style files is described here.)

Timeline for d2vdll1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vdll2