Lineage for d2vdie2 (2vdi E:151-475)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838730Protein automated matches [226984] (16 species)
    not a true protein
  7. 2838744Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225548] (9 PDB entries)
  8. 2838805Domain d2vdie2: 2vdi E:151-475 [198422]
    Other proteins in same PDB: d2vdia1, d2vdib1, d2vdic1, d2vdid1, d2vdie1, d2vdif1, d2vdig1, d2vdih1, d2vdii_, d2vdij_, d2vdik_, d2vdil_, d2vdim_, d2vdin_, d2vdio_, d2vdip_
    automated match to d1wdda1
    complexed with cap, edo, mg; mutant

Details for d2vdie2

PDB Entry: 2vdi (more details), 2.65 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large- subunit c192s mutation
PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2vdie2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdie2 c.1.14.1 (E:151-475) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
pphgiqverdklnkygrgllgctikpklglsaknygravyeslrggldftkddenvnsqp
fmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdyl
tggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsgt
vvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpal
veifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsack
wspelaaacevwkeikfefdtidkl

SCOPe Domain Coordinates for d2vdie2:

Click to download the PDB-style file with coordinates for d2vdie2.
(The format of our PDB-style files is described here.)

Timeline for d2vdie2: