SCOP 1.61: Domain d2f19l1: 2f19 L:1-108

Lineage for d2f19l1 (2f19 L:1-108)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab R19.9 (mouse), kappa L chain [48766] (2 PDB entries)

8. Domain d2f19l1: 2f19 L:1-108 [19842]
   Other proteins in same PDB: d2f19h2, d2f19l2

Details for d2f19l1

PDB Entry: 2f19, 2.8 Å

PDB Description: three-dimensional structure of two crystal forms of fab r19.9, from a monoclonal anti-arsonate antibody

SCOP Domain Sequences for d2f19l1:

Sequence; same for both SEQRES and ATOM records:

>d2f19l1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab R19.9 (mouse), kappa L chain}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltisnlehediatyfcqqgstlprtfgggtkleikr

Timeline for d2f19l1:

• d2f19l1 first appeared (with stable ids) in SCOP 1.55
  
• d2f19l1 appears in SCOP 1.59
  
• d2f19l1 appears in SCOP 1.63
  
• d2f19l1 appears in the current release, SCOPe 2.08