Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (10 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (2 PDB entries) |
Domain d2vdib1: 2vdi B:8-150 [198415] Other proteins in same PDB: d2vdia2, d2vdib2, d2vdic2, d2vdid2, d2vdie2, d2vdif2, d2vdig2, d2vdih2, d2vdii_, d2vdij_, d2vdik_, d2vdil_, d2vdim_, d2vdin_, d2vdio_, d2vdip_ automated match to d1wdda2 complexed with cap, edo, mg; mutant |
PDB Entry: 2vdi (more details), 2.65 Å
SCOPe Domain Sequences for d2vdib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vdib1 d.58.9.0 (B:8-150) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} kagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwt tvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgf kalralrledlrippayvktfvg
Timeline for d2vdib1: