SCOPe 2.03: Domain d2vdhh1: 2vdh H:11-150

Lineage for d2vdhh1 (2vdh H:11-150)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (10 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (2 PDB entries)

8. Domain d2vdhh1: 2vdh H:11-150 [198411]
   Other proteins in same PDB: d2vdha2, d2vdhb2, d2vdhc2, d2vdhd2, d2vdhe2, d2vdhf2, d2vdhg2, d2vdhh2, d2vdhi_, d2vdhj_, d2vdhk_, d2vdhl_, d2vdhm_, d2vdhn_, d2vdho_, d2vdhp_
   automated match to d1wdda2
   complexed with cap, edo, mg; mutant

Details for d2vdhh1

PDB Entry: 2vdh, 2.3 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit c172s mutation

PDB Compounds: (H:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2vdhh1:

Sequence; same for both SEQRES and ATOM records:

>d2vdhh1 d.58.9.0 (H:11-150) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfvg

Timeline for d2vdhh1:

• d2vdhh1 is new in SCOPe 2.03-stable
  
• d2vdhh1 appears in SCOPe 2.04
  
• d2vdhh1 appears in the current release, SCOPe 2.08