SCOP 1.65: Domain d1ineh1: 1ine H:1-114

Lineage for d1ineh1 (1ine H:1-114)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (47 PDB entries)

8. Domain d1ineh1: 1ine H:1-114 [19841]
   Other proteins in same PDB: d1ineh2, d1inel1, d1inel2
   part of Fab Cha255
   complexed with eot, fe

Details for d1ineh1

PDB Entry: 1ine, 2.8 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate

SCOP Domain Sequences for d1ineh1:

Sequence; same for both SEQRES and ATOM records:

>d1ineh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
evtlvesggdsvkpggslklscaasgftlsgetmswvrqtpekrlewvattlsgggftfy
sasvkgrftisrdnaqnnlylqlnslrsedtalyfcashrfvhwghgtlvtvsa

Timeline for d1ineh1:

• d1ineh1 first appeared (with stable ids) in SCOP 1.55
  
• d1ineh1 appears in SCOP 1.63
  
• d1ineh1 appears in SCOP 1.67
  
• d1ineh1 appears in the current release, SCOPe 2.08