Lineage for d1ineh1 (1ine H:1-114)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158041Species Fab Cha255 (mouse), lambda L chain [48765] (2 PDB entries)
  8. 158044Domain d1ineh1: 1ine H:1-114 [19841]
    Other proteins in same PDB: d1ineh2, d1inel2

Details for d1ineh1

PDB Entry: 1ine (more details), 2.8 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate

SCOP Domain Sequences for d1ineh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ineh1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab Cha255 (mouse), lambda L chain}
evtlvesggdsvkpggslklscaasgftlsgetmswvrqtpekrlewvattlsgggftfy
sasvkgrftisrdnaqnnlylqlnslrsedtalyfcashrfvhwghgtlvtvsa

SCOP Domain Coordinates for d1ineh1:

Click to download the PDB-style file with coordinates for d1ineh1.
(The format of our PDB-style files is described here.)

Timeline for d1ineh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ineh2