SCOP 1.55: Domain d1ineh1: 1ine H:1-114

Lineage for d1ineh1 (1ine H:1-114)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab Cha255 (mouse), lambda L chain [48765] (2 PDB entries)

8. Domain d1ineh1: 1ine H:1-114 [19841]
   Other proteins in same PDB: d1ineh2, d1inel2

Details for d1ineh1

PDB Entry: 1ine, 2.8 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate

SCOP Domain Sequences for d1ineh1:

Sequence; same for both SEQRES and ATOM records:

>d1ineh1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab Cha255 (mouse), lambda L chain}
evtlvesggdsvkpggslklscaasgftlsgetmswvrqtpekrlewvattlsgggftfy
sasvkgrftisrdnaqnnlylqlnslrsedtalyfcashrfvhwghgtlvtvsa

Timeline for d1ineh1:

• d1ineh1 appears in SCOP 1.57
  
• d1ineh1 appears in the current release, SCOPe 2.08