SCOPe 2.05: Domain d2v7qf3: 2v7q F:358-474

Lineage for d2v7qf3 (2v7q F:358-474)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
   Uniprot P00829

8. Domain d2v7qf3: 2v7q F:358-474 [198396]
   Other proteins in same PDB: d2v7qa1, d2v7qa2, d2v7qa3, d2v7qb1, d2v7qb2, d2v7qb3, d2v7qc1, d2v7qc2, d2v7qc3, d2v7qd1, d2v7qd2, d2v7qe1, d2v7qe2, d2v7qf1, d2v7qf2, d2v7qg_, d2v7qh1, d2v7qh2, d2v7qi_, d2v7qj_
   automated match to d1w0jd1
   complexed with adp, atp, mg, po4

Details for d2v7qf3

PDB Entry: 2v7q, 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.

PDB Compounds: (F:) ATP synthase subunit beta

SCOPe Domain Sequences for d2v7qf3:

Sequence; same for both SEQRES and ATOM records:

>d2v7qf3 a.69.1.1 (F:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

Timeline for d2v7qf3:

• d2v7qf3 first appeared in SCOPe 2.03
  
• d2v7qf3 appears in SCOPe 2.04
  
• d2v7qf3 appears in SCOPe 2.06
  
• d2v7qf3 appears in the current release, SCOPe 2.08