SCOPe 2.03: Domain d2v7qe2: 2v7q E:82-357

Lineage for d2v7qe2 (2v7q E:82-357)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries)
   Uniprot P00829

8. Domain d2v7qe2: 2v7q E:82-357 [198392]
   Other proteins in same PDB: d2v7qd1, d2v7qd3, d2v7qe1, d2v7qe3, d2v7qf1, d2v7qf3, d2v7qg_, d2v7qh1, d2v7qh2, d2v7qi_, d2v7qj1
   automated match to d1w0jd3
   complexed with adp, atp, mg, po4

Details for d2v7qe2

PDB Entry: 2v7q, 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.

PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d2v7qe2:

Sequence; same for both SEQRES and ATOM records:

>d2v7qe2 c.37.1.11 (E:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

Timeline for d2v7qe2:

• d2v7qe2 is new in SCOPe 2.03-stable
  
• d2v7qe2 appears in SCOPe 2.04
  
• d2v7qe2 appears in the current release, SCOPe 2.08