SCOPe 2.03: Domain d2uylv1: 2uyl V:1-112

Lineage for d2uylv1 (2uyl V:1-112)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries)

8. Domain d2uylv1: 2uyl V:1-112 [198374]
   Other proteins in same PDB: d2uyla2, d2uylb1, d2uylm2, d2uyln1, d2uylv2, d2uylw1, d2uylx2, d2uyly1
   automated match to d1blna1

Details for d2uylv1

PDB Entry: 2uyl, 2.5 Å

PDB Description: Crystal structure of a monoclonal antibody directed against an antigenic determinant common to Ogawa and Inaba serotypes of Vibrio cholerae O1

PDB Compounds: (V:) monoclonal antibody f-22-30

SCOPe Domain Sequences for d2uylv1:

Sequence; same for both SEQRES and ATOM records:

>d2uylv1 b.1.1.1 (V:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtppslpvslgdqasiscrssqsivhsngdtylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftleisrveaedlgvyycfqgshvprtfgggtkleik

Timeline for d2uylv1:

• d2uylv1 is new in SCOPe 2.03-stable
  
• d2uylv1 appears in SCOPe 2.04
  
• d2uylv1 appears in the current release, SCOPe 2.08