SCOP 1.63: Domain d1qlrd1: 1qlr D:1-120

Lineage for d1qlrd1 (1qlr D:1-120)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
Species Fab Kau cold agglutinin (human) IgM, kappa L chain [48764] (2 PDB entries)
Domain d1qlrd1: 1qlr D:1-120 [19837]
Other proteins in same PDB: d1qlra2, d1qlrb2, d1qlrc2, d1qlrd2
complexed with fuc, nag

Details for d1qlrd1

PDB Entry: 1qlr (more details), 2.83 Å

PDB Description: crystal structure of the fab fragment of a human monoclonal igm cold agglutinin

SCOP Domain Sequences for d1qlrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlrd1 b.1.1.1 (D:1-120) Immunoglobulin (variable domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain}
evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss

SCOP Domain Coordinates for d1qlrd1:

Click to download the PDB-style file with coordinates for d1qlrd1.
(The format of our PDB-style files is described here.)

Timeline for d1qlrd1: