Lineage for d2uwwh2 (2uww H:36-251)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790502Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1790503Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1790504Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1790505Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1790506Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
    Uniprot P11846
  8. 1790515Domain d2uwwh2: 2uww H:36-251 [198355]
    Other proteins in same PDB: d2uwwh1, d2uwwl_, d2uwwm_
    automated match to d1l9bh1
    complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10, uq2

Details for d2uwwh2

PDB Entry: 2uww (more details), 2.05 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 6.5 in the neutral state
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2uwwh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uwwh2 b.41.1.1 (H:36-251) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksv

SCOPe Domain Coordinates for d2uwwh2:

Click to download the PDB-style file with coordinates for d2uwwh2.
(The format of our PDB-style files is described here.)

Timeline for d2uwwh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2uwwh1