SCOPe 2.03: Domain d1qlra1: 1qlr A:1-107

Lineage for d1qlra1 (1qlr A:1-107)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries)
Domain d1qlra1: 1qlr A:1-107 [19834]
Other proteins in same PDB: d1qlra2, d1qlrb1, d1qlrb2, d1qlrc2, d1qlrd1, d1qlrd2
part of Fab Kau cold agglutinin IgM

Details for d1qlra1

PDB Entry: 1qlr (more details), 2.83 Å

PDB Description: crystal structure of the fab fragment of a human monoclonal igm cold agglutinin

PDB Compounds: (A:) igm kappa chain v-III (kau cold agglutinin)

SCOPe Domain Sequences for d1qlra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkveik

SCOPe Domain Coordinates for d1qlra1:

Click to download the PDB-style file with coordinates for d1qlra1.
(The format of our PDB-style files is described here.)

Timeline for d1qlra1: