SCOP 1.75: Domain d1dn0d1: 1dn0 D:1-120

Lineage for d1dn0d1 (1dn0 D:1-120)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 2.1 [TaxId:9606] [88545] (3 PDB entries)

8. Domain d1dn0d1: 1dn0 D:1-120 [19833]
   Other proteins in same PDB: d1dn0a1, d1dn0a2, d1dn0b2, d1dn0c1, d1dn0c2, d1dn0d2
   part of Fab Kau cold agglutinin IgM

Details for d1dn0d1

PDB Entry: 1dn0, 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin

PDB Compounds: (D:) igm-kappa cold agglutinin (heavy chain)

SCOP Domain Sequences for d1dn0d1:

Sequence; same for both SEQRES and ATOM records:

>d1dn0d1 b.1.1.1 (D:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]}
evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss

Timeline for d1dn0d1:

• d1dn0d1 first appeared (with stable ids) in SCOP 1.55
  
• d1dn0d1 appears in SCOP 1.73
  
• d1dn0d1 appears in SCOPe 2.01
  
• d1dn0d1 appears in the current release, SCOPe 2.08