SCOP 1.55: Domain d1dn0d1: 1dn0 D:1-120

Lineage for d1dn0d1 (1dn0 D:1-120)

Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
Species Fab Kau cold agglutinin (human) IgM, kappa L chain [48764] (2 PDB entries)
Domain d1dn0d1: 1dn0 D:1-120 [19833]
Other proteins in same PDB: d1dn0a2, d1dn0b2, d1dn0c2, d1dn0d2

Details for d1dn0d1

PDB Entry: 1dn0 (more details), 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin

SCOP Domain Sequences for d1dn0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dn0d1 b.1.1.1 (D:1-120) Immunoglobulin (variable domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain}
evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss

SCOP Domain Coordinates for d1dn0d1:

Click to download the PDB-style file with coordinates for d1dn0d1.
(The format of our PDB-style files is described here.)

Timeline for d1dn0d1: