Lineage for d2r0wl1 (2r0w L:1-106A)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1513189Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)
  8. 1513312Domain d2r0wl1: 2r0w L:1-106A [198319]
    Other proteins in same PDB: d2r0wh1, d2r0wl2
    automated match to d1blna1
    complexed with na

Details for d2r0wl1

PDB Entry: 2r0w (more details), 2.5 Å

PDB Description: pfa2 fab complexed with abeta1-8
PDB Compounds: (L:) IgG2a Fab fragment light chain

SCOPe Domain Sequences for d2r0wl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r0wl1 b.1.1.1 (L:1-106A) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtkleik

SCOPe Domain Coordinates for d2r0wl1:

Click to download the PDB-style file with coordinates for d2r0wl1.
(The format of our PDB-style files is described here.)

Timeline for d2r0wl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r0wl2
View in 3D
Domains from other chains:
(mouse over for more information)
d2r0wh1