Lineage for d1dn0b1 (1dn0 B:1-120)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158254Species Fab Kau cold agglutinin (human) IgM, kappa L chain [48764] (2 PDB entries)
  8. 158256Domain d1dn0b1: 1dn0 B:1-120 [19831]
    Other proteins in same PDB: d1dn0a2, d1dn0b2, d1dn0c2, d1dn0d2

Details for d1dn0b1

PDB Entry: 1dn0 (more details), 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin

SCOP Domain Sequences for d1dn0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin (variable domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain}
evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss

SCOP Domain Coordinates for d1dn0b1:

Click to download the PDB-style file with coordinates for d1dn0b1.
(The format of our PDB-style files is described here.)

Timeline for d1dn0b1: