Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein Green fluorescent protein, GFP [54513] (6 species) |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries) Uniprot P42212 |
Domain d2qlec_: 2qle C: [198309] Other proteins in same PDB: d2qlea2 automated match to d2qled_ complexed with imd; mutant |
PDB Entry: 2qle (more details), 1.59 Å
SCOPe Domain Sequences for d2qlec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qlec_ d.22.1.1 (C:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]} geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt fgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnri elkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyq qntpigdgpvllpdnhylstqvalskdpnekrdhmvllefvtaagith
Timeline for d2qlec_:
View in 3D Domains from other chains: (mouse over for more information) d2qlea1, d2qlea2, d2qleb_, d2qled_ |