Lineage for d2q8bl1 (2q8b L:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370411Domain d2q8bl1: 2q8b L:1-107 [198294]
    Other proteins in same PDB: d2q8bh1, d2q8bl2
    automated match to d1dqdl1

Details for d2q8bl1

PDB Entry: 2q8b (more details), 2.3 Å

PDB Description: Structure of the malaria antigen AMA1 in complex with a growth-inhibitory antibody
PDB Compounds: (L:) 1F9 light chain

SCOPe Domain Sequences for d2q8bl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q8bl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sivmtqtpkflpvsagdrvtiickasqsvsndvvwyqqkpgqspklliyyasirytgvpd
rftgsgygtdftftistvqvedlavyfcqqgfssprtfgggtklein

SCOPe Domain Coordinates for d2q8bl1:

Click to download the PDB-style file with coordinates for d2q8bl1.
(The format of our PDB-style files is described here.)

Timeline for d2q8bl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q8bl2
View in 3D
Domains from other chains:
(mouse over for more information)
d2q8bh1