SCOPe 2.06: Domain d2q87a_: 2q87 A:

Lineage for d2q87a_ (2q87 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d2q87a_: 2q87 A: [198290]
   Other proteins in same PDB: d2q87b2, d2q87c2
   automated match to d2q87b_

Details for d2q87a_

PDB Entry: 2q87, 1.7 Å

PDB Description: the crystal structure of the human irp60 ectodomain

PDB Compounds: (A:) CMRF35-H antigen

SCOPe Domain Sequences for d2q87a_:

Sequence; same for both SEQRES and ATOM records:

>d2q87a_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skartvagpvggslsvqcpyekehrtlnkywcrppqiflcdkivetkgsagkrngrvsir
dspanlsftvtlenlteedagtywcgvdtpwlqdfhdpvvevevsvf

Timeline for d2q87a_:

• d2q87a_ first appeared in SCOPe 2.03
  
• d2q87a_ appears in SCOPe 2.05
  
• d2q87a_ appears in SCOPe 2.07
  
• d2q87a_ appears in the current release, SCOPe 2.08