Lineage for d1dqlh_ (1dql H:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652328Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (19 PDB entries)
  8. 652339Domain d1dqlh_: 1dql H: [19829]
    Other proteins in same PDB: d1dqll_
    part of IgM Fv MEZ

Details for d1dqlh_

PDB Entry: 1dql (more details), 2.6 Å

PDB Description: crystal structure of an unliganded (native) fv from a human igm anti- peptide antibody
PDB Compounds: (H:) igm mez immunoglobulin

SCOP Domain Sequences for d1dqlh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqlh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfssyamhwvrqapgkglewvavissdggnkyy
tdsvkgrftisrndskntlylqmnslrtedtavfycargnppyssgwgggdywgqgtmvt
vss

SCOP Domain Coordinates for d1dqlh_:

Click to download the PDB-style file with coordinates for d1dqlh_.
(The format of our PDB-style files is described here.)

Timeline for d1dqlh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dqll_