SCOP 1.73: Domain d1dqll_: 1dql L:

Lineage for d1dqll_ (1dql L:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (18 PDB entries)

8. Domain d1dqll_: 1dql L: [19828]
   Other proteins in same PDB: d1dqlh_
   part of IgM Fv MEZ

Details for d1dqll_

PDB Entry: 1dql, 2.6 Å

PDB Description: crystal structure of an unliganded (native) fv from a human igm anti- peptide antibody

PDB Compounds: (L:) igm mez immunoglobulin

SCOP Domain Sequences for d1dqll_:

Sequence; same for both SEQRES and ATOM records:

>d1dqll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdirndlgwyqqkpgkapkkliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyyclqqnsnwtfgqgtkvdik

Timeline for d1dqll_:

• d1dqll_ first appeared (with stable ids) in SCOP 1.55
  
• d1dqll_ appears in SCOP 1.71
  
• d1dqll_ appears in SCOP 1.75
  
• d1dqll_ appears in the current release, SCOPe 2.08