Lineage for d1mak__ (1mak -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157850Species Fab 26-10 (mouse), kappa L chain [48761] (4 PDB entries)
  8. 157858Domain d1mak__: 1mak - [19825]

Details for d1mak__

PDB Entry: 1mak (more details)

PDB Description: solution structure of an isolated antibody vl domain
PDB Compounds: ( :)

SCOP Domain Sequences for d1mak__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mak__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Fab 26-10 (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikr

SCOP Domain Coordinates for d1mak__:

Click to download the PDB-style file with coordinates for d1mak__.
(The format of our PDB-style files is described here.)

Timeline for d1mak__: