Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Fab 26-10 (mouse), kappa L chain [48761] (4 PDB entries) |
Domain d1mak__: 1mak - [19825] |
PDB Entry: 1mak (more details)
SCOP Domain Sequences for d1mak__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mak__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Fab 26-10 (mouse), kappa L chain} dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikr
Timeline for d1mak__: