Lineage for d1maj__ (1maj -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363551Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (121 PDB entries)
  8. 363701Domain d1maj__: 1maj - [19824]
    VL of antibody 26-10 only

Details for d1maj__

PDB Entry: 1maj (more details)

PDB Description: solution structure of an isolated antibody vl domain

SCOP Domain Sequences for d1maj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1maj__ b.1.1.1 (-) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikr

SCOP Domain Coordinates for d1maj__:

Click to download the PDB-style file with coordinates for d1maj__.
(The format of our PDB-style files is described here.)

Timeline for d1maj__: