SCOP 1.63: Domain d1maj__: 1maj -

Lineage for d1maj__ (1maj -)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab 26-10 (mouse), kappa L chain [48761] (4 PDB entries)

8. Domain d1maj__: 1maj - [19824]
   VL domain only

Details for d1maj__

PDB Entry: 1maj

PDB Description: solution structure of an isolated antibody vl domain

SCOP Domain Sequences for d1maj__:

Sequence; same for both SEQRES and ATOM records:

>d1maj__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Fab 26-10 (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikr

Timeline for d1maj__:

• d1maj__ first appeared (with stable ids) in SCOP 1.55
  
• d1maj__ appears in SCOP 1.61
  
• d1maj__ appears in SCOP 1.65
  
• d1maj__ appears in the current release, SCOPe 2.08, called d1maja_