Lineage for d1maj__ (1maj -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) 
Species Fab 26-10 (mouse), kappa L chain [48761] (4 PDB entries) 
Domain d1maj__: 1maj - [19824]
Details for d1maj__
PDB Entry: 1maj (more details)
PDB Description: solution structure of an isolated antibody vl domain
SCOP Domain Sequences for d1maj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1maj__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {Fab 26-10 (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikr
SCOP Domain Coordinates for d1maj__:
Click to download the PDB-style file with coordinates for d1maj__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1maj__:
- d1maj__ appears in SCOP 1.57
- d1maj__ appears in the current release, SCOPe 2.08, called d1maja_
View in 3D