Lineage for d2p5ub_ (2p5u B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108959Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries)
  8. 2108994Domain d2p5ub_: 2p5u B: [198232]
    automated match to d2p5ud_
    complexed with nad

Details for d2p5ub_

PDB Entry: 2p5u (more details), 2.37 Å

PDB Description: crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with nad
PDB Compounds: (B:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d2p5ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p5ub_ c.2.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrvlvtggagfigshivedllarglevavldnlatgkrenvpkgvpffrvdlrdkegver
afrefrpthvshqaaqasvkvsvedpvldfevnllgglnlleacrqygveklvfastgga
iygevpegeraeetwpprpkspyaaskaafehylsvygqsyglkwvslrygnvygprqdp
hgeagvvaifaervlkglpvtlyarktpgdegcvrdyvyvgdvaeahalalfslegiynv
gtgeghttrevlmavaeaagkapevqpapprpgdlersvlsplklmahgwrpkvgfqegi
rltvdhfrgav

SCOPe Domain Coordinates for d2p5ub_:

Click to download the PDB-style file with coordinates for d2p5ub_.
(The format of our PDB-style files is described here.)

Timeline for d2p5ub_: