SCOPe 2.05: Domain d2p5ua_: 2p5u A:

Lineage for d2p5ua_ (2p5u A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries)

8. Domain d2p5ua_: 2p5u A: [198231]
   automated match to d2p5ud_
   complexed with nad

Details for d2p5ua_

PDB Entry: 2p5u, 2.37 Å

PDB Description: crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with nad

PDB Compounds: (A:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d2p5ua_:

Sequence; same for both SEQRES and ATOM records:

>d2p5ua_ c.2.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrvlvtggagfigshivedllarglevavldnlatgkrenvpkgvpffrvdlrdkegver
afrefrpthvshqaaqasvkvsvedpvldfevnllgglnlleacrqygveklvfastgga
iygevpegeraeetwpprpkspyaaskaafehylsvygqsyglkwvslrygnvygprqdp
hgeagvvaifaervlkglpvtlyarktpgdegcvrdyvyvgdvaeahalalfslegiynv
gtgeghttrevlmavaeaagkapevqpapprpgdlersvlsplklmahgwrpkvgfqegi
rltvdhfrgav

Timeline for d2p5ua_:

• d2p5ua_ first appeared in SCOPe 2.03
  
• d2p5ua_ appears in SCOPe 2.04
  
• d2p5ua_ appears in SCOPe 2.06
  
• d2p5ua_ appears in the current release, SCOPe 2.08