Lineage for d2orbm1 (2orb M:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1513189Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)
  8. 1513299Domain d2orbm1: 2orb M:1-107 [198219]
    Other proteins in same PDB: d2orbh1, d2orbi1, d2orbl2, d2orbm2
    automated match to d1h0da1
    complexed with so4

Details for d2orbm1

PDB Entry: 2orb (more details), 2.2 Å

PDB Description: The structure of the anti-c-myc antibody 9E10 Fab fragment
PDB Compounds: (M:) Monoclonal anti-c-myc antibody 9E10

SCOPe Domain Sequences for d2orbm1:

Sequence, based on SEQRES records: (download)

>d2orbm1 b.1.1.1 (M:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasesvdnygfsfmnwfqqkpgqppklliyaisnrgs
gvparfsgsgsgtdfslnihpveeddpamyfcqqtkevpwtfgggtkleik

Sequence, based on observed residues (ATOM records): (download)

>d2orbm1 b.1.1.1 (M:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasesvdmnwfqqkpgqppklliyaisnrgsgvparf
sgsgsgtdfslnihpveeddpamyfcqqtevpwtfgggtkleik

SCOPe Domain Coordinates for d2orbm1:

Click to download the PDB-style file with coordinates for d2orbm1.
(The format of our PDB-style files is described here.)

Timeline for d2orbm1: